HORDB

ID: hor002207
Uniprot ID: Q6INW9
Protein name: Insulin-like growth factor II-B
Gene name: igf2-b
Organism: Xenopus laevis (African clawed frog)
Family: Insulin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Xenopus (subgenus), Xenopus (genus), Xenopodinae (subfamily), Pipidae (family), Pipoidea (superfamily), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005178 integrin binding; GO:0005179 hormone activity; GO:0008083 growth factor activity
GO BP: GO:0007165 signal transduction; GO:0007399 nervous system development; GO:0008284 positive regulation of cell population proliferation; GO:0030154 cell differentiation; GO:0060323 head morphogenesis
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: YRPTETLCGGELVDTLQFVCGDRGFYFSTNNGRSNRRSNRGIVEECCFRSCDLELLETYCAKPSKNE
Length: 67
Propeptide: MEQLSCKHRSSSMEAEAQLCRQTESRSTQLPRMSVMRHLFLLSITFLVYTLDSAKAYRPTETLCGGELVDTLQFVCGDRGFYFSTNNGRSNRRSNRGIVEECCFRSCDLELLETYCAKPSKNERDVSTAPATAIPPMNKQDLYHKHHHTKSSKYDIWQRKSIHRLRRGVPAIVRARQYRLLMQKAEESEQALLHRPLTTLPITRPLHLQQTSEPSHN
Signal peptide: MEQLSCKHRSSSMEAEAQLCRQTESRSTQLPRMSVMRHLFLLSITFLVYTLDSAKA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. Promotes anterior neural development
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002207_AF2.pdb

hor002207_ESM.pdb

Mass:	882790	Formula:	C324H506N96O107S6
Absent amino acids:	HMW	Common amino acids:	ERCGL
pI:	5.02	Basic residues:	9
Polar residues:	30	Hydrophobic residues:	15
Hydrophobicity:	-66.27	Boman Index:	-18477
Half-Life:	2.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	2 min	Aliphatic Index	55.22
Instability Index:	5636.87	Extinction Coefficient cystines:	4845
Absorbance 280nm:	73.41